Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marmota monax Interferon gamma (IFNG)

Product Specifications

Product Name Alternative

Short name: IFN-gamma

Abbreviation

Recombinant Marmota monax IFNG protein

Gene Name

IFNG

UniProt

O35735

Expression Region

24-166aa

Organism

Marmota monax (Woodchuck)

Target Sequence

QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Stem Cells

Relevance

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Molecular Weight

18.6 kDa

References & Citations

"Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Escherichia coli O1:K1/APEC syd Polyclonal Antibody
MBS7167025 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC syd Polyclonal Antibody

Ask
View Details
C-myc (Myc, myc-1, Cellular myelocytomatosis oncogene, Myc2, Niard, Nird, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog) (HRP) discontinued
C0035-10A-HRP 100 µL

C-myc (Myc, myc-1, Cellular myelocytomatosis oncogene, Myc2, Niard, Nird, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog) (HRP) discontinued

Ask
View Details
Human P2Y2 knockout cell line
ABC-KH17949 1 Vial

Human P2Y2 knockout cell line

Ask
View Details