Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Envelope glycoprotein L (gL)

Product Specifications

Product Name Alternative

Glycoprotein 25 Short name: gp25

Abbreviation

Recombinant Epstein-Barr virus gL protein

Gene Name

GL

UniProt

P03212

Expression Region

23-137aa

Organism

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Target Sequence

NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. Fusion of EBV with B-lymphocytes requires the additional receptor-binding protein gp42, which forms a complex with gH/gL. May also be required for virus attachment to epithelial cells

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH. Fusion of EBV with B-lymphocytes requires the additional receptor-binding protein gp42, which forms a complex with gH/gL.

Molecular Weight

28.7 kDa

References & Citations

"The Epstein-Barr virus (EBV) BZLF2 gene product associates with the gH and gL homologs of EBV and carries an epitope critical to infection of B cells but not of epithelial cells."Li Q., Turk S.M., Hutt-Fletcher L.M.J. Virol. 69:3987-3994 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine
295643-01 50 mg

6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine

Sign In for Pricing
View Details
6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine
295643-02 100 mg

6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine

Sign In for Pricing
View Details
6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine
295643-03 250 mg

6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine

Sign In for Pricing
View Details
6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine
295643-04 500 mg

6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine

Sign In for Pricing
View Details
6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine
295643-05 1 g

6-Chloro-2-iodo-9- (2',3',5'-tri-O-acetyl-b-D-ribofuranosyl) purine

Sign In for Pricing
View Details
NCKAP1, ID (NCKAP1, HEM2, KIAA0587, NAP1, Nck-associated protein 1, Membrane-associated protein HEM-2, p125Nap1)
MBS6006988-01 0.2 mL

NCKAP1, ID (NCKAP1, HEM2, KIAA0587, NAP1, Nck-associated protein 1, Membrane-associated protein HEM-2, p125Nap1)

Sign In for Pricing
View Details