Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phleum pRatense Pollen allergen Phl p 2 (PHLPII)

Product Specifications

Product Name Alternative

Allergen Phl p II Allergen: Phl p 2

Abbreviation

Recombinant Phleum pratense PHLPII protein

Gene Name

PHLPII

UniProt

P43214

Expression Region

27-122aa

Organism

Phleum pratense (Common timothy)

Target Sequence

VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Allergen

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.8 kDa

References & Citations

"Molecular characterization of Phl p II, a major timothy grass (Phleum pratense) pollen allergen."Dolecek C., Vrtala S., Laffer S., Steinberger P., Kraft D., Scheiner O., Valenta R.FEBS Lett. 335:299-304 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ELMO Domain Containing Protein 2 (ELMOD2) ELISA Kit
abx387128 96 Tests

Human ELMO Domain Containing Protein 2 (ELMOD2) ELISA Kit

Sign In for Pricing
View Details
Prkaca (NM_001100922) Rat Untagged Clone
RN201982 10 µg

Prkaca (NM_001100922) Rat Untagged Clone

Sign In for Pricing
View Details
Actin Recombinant Rabbit Monoclonal Antibody [JJ09-29]
ET1701-80 100 µL

Actin Recombinant Rabbit Monoclonal Antibody [JJ09-29]

Sign In for Pricing
View Details
ACTN3 (NM_001104) Human Tagged Lenti ORF Clone
RC211706L2 10 µg

ACTN3 (NM_001104) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Benzoyl-DL-arginine p-nitroanilide monohydrochloride
MDP0021 500 mg

Benzoyl-DL-arginine p-nitroanilide monohydrochloride

Sign In for Pricing
View Details
HFE (NM_139008) Human 3' UTR Clone
SC211810 10 µg

HFE (NM_139008) Human 3' UTR Clone

Sign In for Pricing
View Details