Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phleum pratense Pollen allergen Phl p 1 (PHLPI)

Product Specifications

Product Name Alternative

Allergen Phl p I Allergen: Phl p 1

Abbreviation

Recombinant Phleum pratense PHLPI protein

Gene Name

PHLPI

UniProt

P43213

Expression Region

24-263aa

Organism

Phleum pratense (Common timothy)

Target Sequence

IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Allergen

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.2 kDa

References & Citations

"Complementary DNA cloning of the major allergen Phl p I from timothy grass (Phleum pratense) ; recombinant Phl p I inhibits IgE binding to group I allergens from eight different grass species."Laffer S., Valenta R., Vrtala S., Susani M., van Ree R., Kraft D., Scheiner O., Duchene M.J. Allergy Clin. Immunol. 94:689-698 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LECT2 Antibody (OTI2A11) [Alexa Fluor 350]
NBP2-71122AF350 0.1 mL

Mouse Monoclonal LECT2 Antibody (OTI2A11) [Alexa Fluor 350]

Sign In for Pricing
View Details
pOTB7-PQBP1 Plasmid
PVT25815 2 µg

pOTB7-PQBP1 Plasmid

Sign In for Pricing
View Details
CDC42EP3 (CDC42 Effector Protein (Rho GTPase Binding) 3, BORG2, CEP3, FLJ46903, UB1) (MaxLight 405)
MBS6450667-01 0.1 mL

CDC42EP3 (CDC42 Effector Protein (Rho GTPase Binding) 3, BORG2, CEP3, FLJ46903, UB1) (MaxLight 405)

Sign In for Pricing
View Details
CDC42EP3 (CDC42 Effector Protein (Rho GTPase Binding) 3, BORG2, CEP3, FLJ46903, UB1) (MaxLight 405)
MBS6450667-02 5x 0.1 mL

CDC42EP3 (CDC42 Effector Protein (Rho GTPase Binding) 3, BORG2, CEP3, FLJ46903, UB1) (MaxLight 405)

Sign In for Pricing
View Details
Mrpl36 Rat shRNA Plasmid (Locus ID 364656)
TR707406 1 Kit

Mrpl36 Rat shRNA Plasmid (Locus ID 364656)

Sign In for Pricing
View Details
TRIB3 Polyclonal Antibody
CAC13445-01 50 µg

TRIB3 Polyclonal Antibody

Sign In for Pricing
View Details