Recombinant Betula pendula Profilin (BETVII)
Product Specifications
Product Name Alternative
Allergen Bet v II Pollen allergen Bet v 2 Allergen: Bet v 2
Abbreviation
Recombinant Betula pendula BETVII protein
Gene Name
BETVII
UniProt
P25816
Expression Region
2-133aa
Organism
Betula pendula (European white birch) (Betula verrucosa)
Target Sequence
SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL
Tag
N-terminal 6xHis-SUMO-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Allergen
Relevance
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
Molecular Weight
30.1 kDa
References & Citations
"Analysis of the effects of polymorphism on pollen profilin structural functionality and the generation of conformational, T- and B-cell epitopes."Jimenez-Lopez J.C., Rodriguez-Garcia M.I., Alche J.D.PLoS ONE 8:E76066-E76066 (2013)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881985-100 1x 100 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-0041-01 24 Tests
8-epi-PGF2α (8-Epi-Prostaglandin F2 Alpha) ELISA Kit
Sign In for Pricing
View Details E-EL-0041-02 48 Tests
8-epi-PGF2α (8-Epi-Prostaglandin F2 Alpha) ELISA Kit
Sign In for Pricing
View Details E-EL-0041-03 96 Tests
8-epi-PGF2α (8-Epi-Prostaglandin F2 Alpha) ELISA Kit
Sign In for Pricing
View Details 