Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Envelope glycoprotein B (gB), partial

Product Specifications

Product Name Alternative

GP115 Glycoprotein GP110

Abbreviation

Recombinant Epstein-Barr virus gB protein, partial

Gene Name

GB

UniProt

P03188

Expression Region

23-260aa

Organism

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Target Sequence

QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Envelope glycoprotein that forms spikes at the surface of virion envelope. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding of gp350/220 to its receptor, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Molecular Weight

43.3 kDa

References & Citations

"Epstein-Barr virus glycoprotein homologous to herpes simplex virus gB."Gong M., Ooka T., Matsuo T., Kieff E.J. Virol. 61:499-508 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA3 siRNA (Mouse)
MBS8221581-01 15 nmol

DEFA3 siRNA (Mouse)

Sign In for Pricing
View Details
DEFA3 siRNA (Mouse)
MBS8221581-02 30 nmol

DEFA3 siRNA (Mouse)

Sign In for Pricing
View Details
DEFA3 siRNA (Mouse)
MBS8221581-03 5x 30 nmol

DEFA3 siRNA (Mouse)

Sign In for Pricing
View Details
Linaroside
MBS5765735 Inquire

Linaroside

Sign In for Pricing
View Details
Human Leucine Rich PPR Motif Containing Protein (LRPPRC) ELISA Kit
GTR10344643 96 Well

Human Leucine Rich PPR Motif Containing Protein (LRPPRC) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse BMP8B Protein, N-His
orb3185379-01 20 µg

Recombinant Mouse BMP8B Protein, N-His

Sign In for Pricing
View Details