Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Artemisia vulgaris Major pollen allergen Art v 1

Product Specifications

Product Name Alternative

Defensin-like protein 1 Allergen: Art v 1

Abbreviation

Recombinant Artemisia vulgaris Major pollen allergen Art v 1 protein

UniProt

Q84ZX5

Expression Region

25-132aa

Organism

Artemisia vulgaris (Mugwort)

Target Sequence

AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.8 kDa

References & Citations

"Art v 1, the major allergen of mugwort pollen, is a modular glycoprotein with a defensin-like and a hydroxyproline-rich domain."Himly M., Jahn-Schmid B., Dedic A., Kelemen P., Wopfner N., Altmann F., van Ree R., Briza P., Richter K., Ebner C., Ferreira F.FASEB J. 17:106-108 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse HB-EGF Affinity Purified Polyclonal Ab
AF8239-SP 25 µg

Mouse HB-EGF Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Chitoheptaose 7HCl
296836-01 1 mg

Chitoheptaose 7HCl

Sign In for Pricing
View Details
Chitoheptaose 7HCl
296836-02 5 mg

Chitoheptaose 7HCl

Sign In for Pricing
View Details
Chitoheptaose 7HCl
296836-03 10 mg

Chitoheptaose 7HCl

Sign In for Pricing
View Details
Anti-Human Transthyretin amyloidosis Antibody (6C1)
HP217033-01 50 µg

Anti-Human Transthyretin amyloidosis Antibody (6C1)

Sign In for Pricing
View Details
Anti-Human Transthyretin amyloidosis Antibody (6C1)
HP217033-02 100 µg

Anti-Human Transthyretin amyloidosis Antibody (6C1)

Sign In for Pricing
View Details