Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercurialis annua Profilin

Product Specifications

Product Name Alternative

Pollen allergen Mer a 1 Allergen: Mer a 1

Abbreviation

Recombinant Mercurialis annua Profilin protein

UniProt

O49894

Expression Region

1-133aa

Organism

Mercurialis annua (Annual mercury)

Target Sequence

MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity) .

Molecular Weight

30.3 kDa

References & Citations

"Characterization of recombinant Mercurialis annua major allergen Mer a 1 (profilin) ."Vallverdu A., Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez A., Martinez J., Palacios R.J. Allergy Clin. Immunol. 101:363-370 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnpy4 Mouse Gene Knockout Kit (CRISPR)
KN503572 1 Kit

Cnpy4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2425), CF488A conjugate, 0.1mg/mL
BNC882425-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2425), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,1'-Ferrocenedicarboxylic Acid
TRC-F307620-250MG 250 mg

1,1'-Ferrocenedicarboxylic Acid

Sign In for Pricing
View Details
Vps8 Mouse Gene Knockout Kit (CRISPR)
KN519269 1 Kit

Vps8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Chromobox Homolog 3 (CBX3) ELISA Kit
RDR-CBX3-Hu-01 96 Tests

Human Chromobox Homolog 3 (CBX3) ELISA Kit

Sign In for Pricing
View Details
Human Chromobox Homolog 3 (CBX3) ELISA Kit
RDR-CBX3-Hu-02 48 Tests

Human Chromobox Homolog 3 (CBX3) ELISA Kit

Sign In for Pricing
View Details