What is the catalog number for Recombinant Mercurialis annua Profilin?

The catalog number for Recombinant Mercurialis annua Profilin is CSB-EP525079MQZ.

What sizes are available for Recombinant Mercurialis annua Profilin?

Recombinant Mercurialis annua Profilin is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Mercurialis annua Profilin come in?

Recombinant Mercurialis annua Profilin is available in 3 different pack sizes.

Is Recombinant Mercurialis annua Profilin in stock?

Recombinant Mercurialis annua Profilin is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Mercurialis annua Profilin?

Recombinant Mercurialis annua Profilin is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Mercurialis annua Profilin?

Estimated delivery time for Recombinant Mercurialis annua Profilin is approximately 15 business day(s), depending on your location.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

Recombinant Mercurialis annua Profilin

Product Specifications

Product Name Alternative

Pollen allergen Mer a 1 Allergen: Mer a 1

Abbreviation

Recombinant Mercurialis annua Profilin protein

UniProt

O49894

Expression Region

1-133aa

Organism

Mercurialis annua (Annual mercury)

Target Sequence

MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Molecular Weight

30.3 kDa

References & Citations

"Characterization of recombinant Mercurialis annua major allergen Mer a 1 (profilin) ."Vallverdu A., Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez A., Martinez J., Palacios R.J. Allergy Clin. Immunol. 101:363-370 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.