Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba (albA)

Product Specifications

Product Name Alternative

AlbA; PF1881DNA/RNA-binding protein Alba

Abbreviation

Recombinant Pyrococcus furiosus albA protein

Gene Name

AlbA

UniProt

Q8TZV1

Expression Region

1-93aa

Organism

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Target Sequence

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Molecular Weight

26.4 kDa

References & Citations

"Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences."Maeder D.L., Weiss R.B., Dunn D.M., Cherry J.L., Gonzalez J.M., DiRuggiero J., Robb F.T.Genetics 152:1299-1305 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myeloid leukemia factor 1 (mLF1) (NM_001195433) Human Over-expression Lysate
LC434046 20 µg

Myeloid leukemia factor 1 (mLF1) (NM_001195433) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-Glycinol
TRC-F619975-5G 5 g

Fmoc-Glycinol

Sign In for Pricing
View Details
PDE8B (NM_001029853) Human Over-expression Lysate
LC422472 20 µg

PDE8B (NM_001029853) Human Over-expression Lysate

Sign In for Pricing
View Details
TRAF6 Human Gene Knockout Kit (CRISPR)
KN206042RB 1 Kit

TRAF6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Nitrosotris-(2-chloroethyl)urea 90%
TRC-N547250-25MG 25 mg

N-Nitrosotris-(2-chloroethyl)urea 90%

Sign In for Pricing
View Details
TMEM53 (NM_024587) Human Recombinant Protein
TP309503 20 µg

TMEM53 (NM_024587) Human Recombinant Protein

Sign In for Pricing
View Details