Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba (albA)

Product Specifications

Product Name Alternative

AlbA; PF1881DNA/RNA-binding protein Alba

Abbreviation

Recombinant Pyrococcus furiosus albA protein

Gene Name

AlbA

UniProt

Q8TZV1

Expression Region

1-93aa

Organism

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Target Sequence

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Molecular Weight

26.4 kDa

References & Citations

"Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences."Maeder D.L., Weiss R.B., Dunn D.M., Cherry J.L., Gonzalez J.M., DiRuggiero J., Robb F.T.Genetics 152:1299-1305 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR27 activation kit by CRISPRa
GA116756 1 Kit

Human WDR27 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Solanum tuberosum (Potato) -STA-, 1mL 10nm
GP-4701-10 1 mL

Colloidal Gold Conjugated Solanum tuberosum (Potato) -STA-, 1mL 10nm

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813T-01 25 µg

Elab Fluor® Violet 610 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813T-02 100 µg

Elab Fluor® Violet 610 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,5-Pentanediol
TRC-P273405-25G 25 g

1,5-Pentanediol

Sign In for Pricing
View Details