Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

Product Specifications

Product Name Alternative

RING finger protein 203 Zinc/RING finger protein 3

Abbreviation

Recombinant Human ZNRF3 protein, partial

Gene Name

ZNRF3

UniProt

Q9ULT6

Expression Region

56-219aa

Organism

Homo sapiens (Human)

Target Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone.

Molecular Weight

34.2 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Magic™ Membrane Protein Human VMP1 (Vacuole membrane protein 1) Expressed in vitro E.coli expression system, Full Length
MPX3539K Each

Magic™ Membrane Protein Human VMP1 (Vacuole membrane protein 1) Expressed in vitro E.coli expression system, Full Length

Ask
View Details
CSK Antibody
MBS7121909-01 0.05 mg

CSK Antibody

Ask
View Details
CSK Antibody
MBS7121909-02 0.1 mg

CSK Antibody

Ask
View Details
CSK Antibody
MBS7121909-03 5x 0.1 mg

CSK Antibody

Ask
View Details
Recombinant Leucophyllum frutescens Translation initiation factor IF-1, chloroplastic (infA)
MBS1287123-01 0.05 mg (E-Coli)

Recombinant Leucophyllum frutescens Translation initiation factor IF-1, chloroplastic (infA)

Ask
View Details
Recombinant Leucophyllum frutescens Translation initiation factor IF-1, chloroplastic (infA)
MBS1287123-02 0.2 mg (E-Coli)

Recombinant Leucophyllum frutescens Translation initiation factor IF-1, chloroplastic (infA)

Ask
View Details