Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir (tir), partial

Product Specifications

Product Name Alternative

Secreted effector protein Tir

Abbreviation

Recombinant E.coli O157:H7 tir protein, partial

Gene Name

Tir

UniProt

C6UYL8

Expression Region

252-362aa

Organism

Escherichia coli O157:H7 (strain TW14359 / EHEC)

Target Sequence

QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The Extracellular domain region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The extracellular region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion (By similarity) .

Molecular Weight

27.8 kDa

References & Citations

"Analysis of the genome of the Escherichia coli O157:H7 2006 spinach-associated outbreak isolate indicates candidate genes that may enhance virulence."Kulasekara B.R., Jacobs M., Zhou Y., Wu Z., Sims E., Saenphimmachak C., Rohmer L., Ritchie J.M., Radey M., McKevitt M., Freeman T.L., Hayden H., Haugen E., Gillett W., Fong C., Chang J., Beskhlebnaya V., Waldor M.K. Miller S.I.Infect. Immun. 77:3713-3721 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LSM3 Antibody [Alexa Fluor 750]
NBP3-00316AF750 0.1 mL

Rabbit Polyclonal LSM3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Ferd3l ORF Vector (Mouse) (pORF)
ORF044775 1.0 µg DNA

Ferd3l ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Dok-4 (Docking Protein 4, Downstream of Tyrosine Kinase 4, Insulin Receptor Substrate 5, IRS-5, IRS5, DOK4) discontinued
222222-01 50 µL

Dok-4 (Docking Protein 4, Downstream of Tyrosine Kinase 4, Insulin Receptor Substrate 5, IRS-5, IRS5, DOK4) discontinued

Sign In for Pricing
View Details
Dok-4 (Docking Protein 4, Downstream of Tyrosine Kinase 4, Insulin Receptor Substrate 5, IRS-5, IRS5, DOK4) discontinued
222222-02 100 µL

Dok-4 (Docking Protein 4, Downstream of Tyrosine Kinase 4, Insulin Receptor Substrate 5, IRS-5, IRS5, DOK4) discontinued

Sign In for Pricing
View Details
Human NKG2C/CD159c (CAA04922) VersaClone cDNA
RDC2584 10 µg

Human NKG2C/CD159c (CAA04922) VersaClone cDNA

Sign In for Pricing
View Details
LINC00426 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV731662 1.0 µg DNA

LINC00426 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details