Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-citRate synthase (ACLY), partial

Product Specifications

Product Name Alternative

ATP-citrate (pro-S-) -lyase Short name:ACL Citrate cleavage enzyme

Abbreviation

Recombinant Human ACLY protein, partial

Gene Name

ACLY

UniProt

P53396

Expression Region

4-265aa

Organism

Homo sapiens (Human)

Target Sequence

KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

ATP-citrate synthase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.

Molecular Weight

45.5 kDa

References & Citations

"Cloning and expression of a human ATP-citrate lyase cDNA."Elshourbagy N.A., Near J.C., Kmetz P.J., Wells T.N.C., Groot P.H.E., Saxty B.A., Hughes S.A., Franklin M., Gloger I.S.Eur. J. Biochem. 204:491-499 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G3BP (G3BP1) Human Gene Knockout Kit (CRISPR)
KN402692 1 Kit

G3BP (G3BP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Live-or-DyeTM Fixable Viability Sampler Kit, Spectral
#32017 1 Kit

Live-or-DyeTM Fixable Viability Sampler Kit, Spectral

Sign In for Pricing
View Details
Recombinant Human TNFRSF12A Protein (Sumo Tag)
PDEH101139-01 20 µg

Recombinant Human TNFRSF12A Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF12A Protein (Sumo Tag)
PDEH101139-02 100 µg

Recombinant Human TNFRSF12A Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF12A Protein (Sumo Tag)
PDEH101139-03 500 µg

Recombinant Human TNFRSF12A Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF12A Protein (Sumo Tag)
PDEH101139-04 1 mg

Recombinant Human TNFRSF12A Protein (Sumo Tag)

Sign In for Pricing
View Details