Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein K3 (VACWR034)

Product Specifications

Product Name Alternative

Protein K2

Abbreviation

Recombinant Vaccinia virus VACWR034 protein

Gene Name

VACWR034

UniProt

P18378

Expression Region

1-88aa

Organism

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Target Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.

Molecular Weight

26.6 kDa

References & Citations

"Non-essential genes in the vaccinia virus HindIII K fragment: a gene related to serine protease inhibitors and a gene related to the 37K vaccinia virus major envelope antigen."Boursnell M.E.G., Foulds I.J., Campbell J.I., Binns M.M.J. Gen. Virol. 69:2995-3003 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HES5 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-60648R-BF555-01 20 µL

HES5 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
HES5 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-60648R-BF555-02 100 µL

HES5 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
ITGA5 (light chain, Cleaved-Glu895) Antibody
MBS853047-01 0.1 mg

ITGA5 (light chain, Cleaved-Glu895) Antibody

Sign In for Pricing
View Details
ITGA5 (light chain, Cleaved-Glu895) Antibody
MBS853047-02 0.1 mL (AF635)

ITGA5 (light chain, Cleaved-Glu895) Antibody

Sign In for Pricing
View Details
ITGA5 (light chain, Cleaved-Glu895) Antibody
MBS853047-03 0.1 mL (AF610)

ITGA5 (light chain, Cleaved-Glu895) Antibody

Sign In for Pricing
View Details
ITGA5 (light chain, Cleaved-Glu895) Antibody
MBS853047-04 0.1 mL (AF405S)

ITGA5 (light chain, Cleaved-Glu895) Antibody

Sign In for Pricing
View Details