Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Phosphocarrier protein HPr (ptsH)

Product Specifications

Product Name Alternative

Histidine-containing protein

Abbreviation

Recombinant Bacillus subtilis ptsH protein

Gene Name

PtsH

UniProt

P08877

Expression Region

2-88aa

Organism

Bacillus subtilis (strain 168)

Target Sequence

AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETMKSEGLGE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS) . This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the permease (enzymes II/III) . P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite-regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS) . This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain.; FUNCTION

Molecular Weight

25.1 kDa

References & Citations

"Phosphoenolpyruvate:sugar phosphotransferase system of Bacillus subtilis: nucleotide sequence of ptsX, ptsH and the 5'-end of ptsI and evidence for a ptsHI operon."Gonzy-Treboul G., Zagorec M., Rain-Guion M.-C., Steinmetz M.Mol. Microbiol. 3:103-112 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

V5 Epitope Tag (Pk-tag, Paramyxovirus, SV5)
MBS604391-01 0.1 mg

V5 Epitope Tag (Pk-tag, Paramyxovirus, SV5)

Ask
View Details
V5 Epitope Tag (Pk-tag, Paramyxovirus, SV5)
MBS604391-02 1 mg

V5 Epitope Tag (Pk-tag, Paramyxovirus, SV5)

Ask
View Details
V5 Epitope Tag (Pk-tag, Paramyxovirus, SV5)
MBS604391-03 5x 1 mg

V5 Epitope Tag (Pk-tag, Paramyxovirus, SV5)

Ask
View Details
HMGB1P26 ORF Vector (Human) (pORF)
23514011 1.0 µg DNA

HMGB1P26 ORF Vector (Human) (pORF)

Ask
View Details
Mouse Monoclonal NFkB p105/p50 Antibody (2J10D7) [DyLight 488]
NB100-56583G 0.1 mL

Mouse Monoclonal NFkB p105/p50 Antibody (2J10D7) [DyLight 488]

Ask
View Details
connexin 46 shRNA Plasmid (m)
sc-43082-SH 20 µg

connexin 46 shRNA Plasmid (m)

Ask
View Details