Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Androctonus australis Alpha-mammal toxin AaH2

Product Specifications

Product Name Alternative

AaH II Short name:AaHII Neurotoxin 2

Abbreviation

Recombinant Androctonus australis Alpha-mammal toxin AaH2 protein

UniProt

P01484

Expression Region

20-83aa

Organism

Androctonus australis (Sahara scorpion)

Target Sequence

VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.

Molecular Weight

23.3 kDa

References & Citations

"Precursors of Androctonus australis scorpion neurotoxins. Structures of precursors, processing outcomes, and expression of a functional recombinant toxin II."Bougis P.E., Rochat H., Smith L.A.J. Biol. Chem. 264:19259-19265 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Kidney
CB526815 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS507219 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
TSGA10 (NM_025244) Human Recombinant Protein
TP305528M 100 µg

TSGA10 (NM_025244) Human Recombinant Protein

Sign In for Pricing
View Details
Biotin, Succinimidyl Ester (Biotin SE)
#90050 1x 100 mg

Biotin, Succinimidyl Ester (Biotin SE)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]
E-AB-F1089M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]
E-AB-F1089M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD73 Antibody[TY/23]

Sign In for Pricing
View Details