Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Odorant-binding protein 2a (OBP2A)

Product Specifications

Product Name Alternative

Odorant-binding protein IIa Short name:OBPIIa

Abbreviation

Recombinant Human OBP2A protein

Gene Name

OBP2A

UniProt

Q9NY56

Expression Region

16-170aa

Organism

Homo sapiens (Human)

Target Sequence

LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Molecular Weight

33.8 kDa

References & Citations

"A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres."Lacazette E., Gachon A.-M., Pitiot G.Hum. Mol. Genet. 9:289-301 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Proteasome 26S S5 Antibody [Alexa Fluor 750]
NB120-3319AF750 0.1 mL

Rabbit Polyclonal Proteasome 26S S5 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Pnpla6 (BC054789) Mouse Tagged ORF Clone
MG211925 10 µg

Pnpla6 (BC054789) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GAPDHP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV726448 1.0 µg DNA

GAPDHP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
11b-Hydroxy Etiocholanolone
TRC-H941930-50MG 50 mg

11b-Hydroxy Etiocholanolone

Sign In for Pricing
View Details
Anti-PON2 Antibody Picoband® Fluoro594 Conjugated
PB9779-Fluoro594 100 µg/Vial

Anti-PON2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
IFluor® 594 Anti-human CD39 Antibody *TU66*
103900C1-AAT 500 Tests

IFluor® 594 Anti-human CD39 Antibody *TU66*

Sign In for Pricing
View Details