Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Galectin-4 (Lgals4)

Product Specifications

Product Name Alternative

L-36 lactose-binding protein Short name: L36LBP Lactose-binding lectin 4

Abbreviation

Recombinant Rat Lgals4 protein

Gene Name

Lgals4

UniProt

P38552

Expression Region

1-324aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Galectin that binds lactose and a related range of sugars.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Galectin that binds lactose and a related range of sugars.

Molecular Weight

52.3 kDa

References & Citations

"Soluble lactose-binding lectin from rat intestine with two different carbohydrate-binding domains in the same peptide chain."Oda Y., Herrmann J., Gitt M., Turck C.W., Burlingame A.L., Barondes S.H., Leffler H.J. Biol. Chem. 268:5929-5939 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-126b miRNA Antagomir
MBS8321046-01 10 nmol

rno-miR-126b miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-126b miRNA Antagomir
MBS8321046-02 20 nmol

rno-miR-126b miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-126b miRNA Antagomir
MBS8321046-03 5x 20 nmol

rno-miR-126b miRNA Antagomir

Sign In for Pricing
View Details
Human Annexin A5 Protein, His Tag
AN5-H5123-1mg 1 mg

Human Annexin A5 Protein, His Tag

Sign In for Pricing
View Details
Sticks used to remove the stirrer
E3323 1 Unit

Sticks used to remove the stirrer

Sign In for Pricing
View Details
PNLIP Polyclonal Antibody
MBS8572903-01 0.1 mL

PNLIP Polyclonal Antibody

Sign In for Pricing
View Details