Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Major urinary protein 6 (Mup6)

Product Specifications

Product Name Alternative

Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1

Abbreviation

Recombinant Mouse Mup6 protein

Gene Name

Mup6

UniProt

P02762

Expression Region

19-180aa

Organism

Mus musculus (Mouse)

Target Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Molecular Weight

34.7 kDa

References & Citations

"Sequence structures of a mouse major urinary protein gene and pseudogene compared."Clark A.J., Ghazal P., Bingham R.W., Barrett D., Bishop J.O.EMBO J. 4:3159-3165 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenylate Kinase 1 (AK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]
TA500361BM 100 µL

Adenylate Kinase 1 (AK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]

Sign In for Pricing
View Details
Recombinant LcK Antibody
RC-5403-01 50 μL

Recombinant LcK Antibody

Sign In for Pricing
View Details
Recombinant LcK Antibody
RC-5403-02 100 µL

Recombinant LcK Antibody

Sign In for Pricing
View Details
Recombinant LcK Antibody
RC-5403-03 1 mL

Recombinant LcK Antibody

Sign In for Pricing
View Details
Brd4 Mouse Gene Knockout Kit (CRISPR)
KN502254 1 Kit

Brd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Twist Polyclonal Antibody
E-AB-67852-01 60 µL

Twist Polyclonal Antibody

Sign In for Pricing
View Details