Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Major urinary protein 6 (Mup6)

Product Specifications

Product Name Alternative

Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1

Abbreviation

Recombinant Mouse Mup6 protein

Gene Name

Mup6

UniProt

P02762

Expression Region

19-180aa

Organism

Mus musculus (Mouse)

Target Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Molecular Weight

34.7 kDa

References & Citations

"Sequence structures of a mouse major urinary protein gene and pseudogene compared."Clark A.J., Ghazal P., Bingham R.W., Barrett D., Bishop J.O.EMBO J. 4:3159-3165 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF405S conjugate, 0.1mg/mL
BNC041827-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI2F3]
CF809544 100 µg

ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI2F3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505979 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Nucleostemin (GNL3) Human Gene Knockout Kit (CRISPR)
KN200066 1 Kit

Nucleostemin (GNL3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF568 conjugate, 0.1mg/mL
BNC682103-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACSM2A (NM_001010845) Human Over-expression Lysate
LY423179 100 µg

ACSM2A (NM_001010845) Human Over-expression Lysate

Sign In for Pricing
View Details