Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Blattella germanica Allergen Bla g 4

Product Specifications

Product Name Alternative

Allergen Bla g IV Allergen: Bla g 4

Abbreviation

Recombinant Blattella germanica Allergen Bla g 4 protein

UniProt

P54962

Expression Region

13-182aa

Organism

Blattella germanica (German cockroach) (Blatta germanica)

Target Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Probable ligand-binding protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable ligand-binding protein.

Molecular Weight

35.8 kDa

References & Citations

"Cloning of cockroach allergen, Bla g 4, identifies ligand binding proteins (or calycins) as a cause of IgE antibody responses."Arruda L.K., Vailes L.D., Hayden M.L., Benjamin D.C., Chapman M.D.J. Biol. Chem. 270:31196-31201 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D1A (NM_001114937) Human Tagged ORF Clone Lentiviral Particle
RC225074L3V 200 µL

SH2D1A (NM_001114937) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)
MBS1389908-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)
MBS1389908-02 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)
MBS1389908-03 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)
MBS1389908-04 0.1 mg (Yeast)

Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)
MBS1389908-05 0.02 mg (Baculovirus)

Recombinant Prochlorococcus marinus subsp. pastoris CinA-like protein (PMM0257)

Sign In for Pricing
View Details