Recombinant Human 40S ribosomal protein S3 (RPS3)

40S ribosomal protein S3; fb13d09; FLJ26283; FLJ27450; IMR 90 ribosomal protein S3; MGC56088; MGC87870; OTTHUMP00000229804; OTTHUMP00000229805; OTTHUMP00000229874; OTTHUMP00000229877; OTTHUMP00000229878; OTTHUMP00000229879; OTTHUMP00000229880; OTTHUMP00000229882; OTTHUMP00000229883; OTTHUMP00000229886; Ribosomal protein S3; rps3; RS3_HUMAN; S3; wu:fb13d09; zgc:56088

AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

Involved in translation as a component of the 40S small ribosomal subunit (PubMed:8706699) . Has endonuclease activity and plays a role in repair of damaged DNA (PubMed:7775413) . Cleaves phosphodiester bonds of DNAs containing altered bases with broad specificity and cleaves supercoiled DNA more efficiently than relaxed DNA (PubMed:15707971) . Displays high binding affinity for 7,8-dihydro-8-oxoguanine (8-oxoG), a common DNA lesion caused by reactive oxygen species (ROS) (PubMed:14706345) . Has also been shown to bind with similar affinity to intact and damaged DNA (PubMed:18610840) . Stimulates the N-glycosylase activity of the base excision protein OGG1 (PubMed:15518571) . Enhances the uracil excision activity of UNG1 (PubMed:18973764) . Also stimulates the cleavage of the phosphodiester backbone by APEX1 (PubMed:18973764) . When located in the mitochondrion, reduces cellular ROS levels and mitochondrial DNA damage (PubMed:23911537) . Has also been shown to negatively regulate DNA repair in cells exposed to hydrogen peroxide (PubMed:17049931) . Plays a role in regulating transcription as part of the NF-kappa-B p65-p50 complex where it binds to the RELA/p65 subunit, enhances binding of the complex to DNA and promotes transcription of target genes (PubMed:18045535) . Represses its own translation by binding to its cognate mRNA (PubMed:20217897) . Binds to and protects TP53/p53 from MDM2-mediated ubiquitination (PubMed:19656744) . Involved in spindle formation and chromosome movement during mitosis by regulating microtubule polymerization (PubMed:23131551) . Involved in induction of apoptosis through its role in activation of CASP8 (PubMed:14988002) . Induces neuronal apoptosis by interacting with the E2F1 transcription factor and acting synergistically with it to up-regulate pro-apoptotic proteins BCL2L11/BIM and HRK/Dp5 (PubMed:20605787) . Interacts with TRADD following exposure to UV radiation and induces apoptosis by caspase-dependent JNK activation (PubMed:22510408) .

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.