Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT

Product Specifications

Product Name Alternative

Lqh-alpha-IT Short name: Alpha-IT

Abbreviation

Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT protein

UniProt

P17728

Expression Region

20-85aa

Organism

Leiurus quinquestriatus hebraeus (Yellow scorpion)

Target Sequence

VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Molecular Weight

23.5 kDa

References & Citations

"Nucleotide sequence and structure analysis of a cDNA encoding an alpha insect toxin from the scorpion Leiurus quinquestriatus hebraeus." Gurevitz M., Urbach D., Zlotkin E., Zilberberg N.Toxicon 29:1270-1272 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) LCR7 Polyclonal Antibody
MBS7149462 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) LCR7 Polyclonal Antibody

Sign In for Pricing
View Details
CPI17 alpha Polyclonal Antibody, APC-Cy7 Conjugated
bs-5149R-APC-Cy7 100 µL

CPI17 alpha Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
CAPN7 (Calpain-7, PalB Homolog, PalBH, PALBH) (MaxLight 650)
124325-ML650 100 µL

CAPN7 (Calpain-7, PalB Homolog, PalBH, PALBH) (MaxLight 650)

Sign In for Pricing
View Details
TSTA1 siRNA Oligos set (Human)
68682171 3x 5 nmol

TSTA1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
CIF1
MBS407603-01 0.1 mg

CIF1

Sign In for Pricing
View Details
CIF1
MBS407603-02 5x 0.1 mg

CIF1

Sign In for Pricing
View Details