Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurotrypsin (PRSS12), partial

Product Specifications

Product Name Alternative

Leydin Motopsin Serine protease 12

Abbreviation

Recombinant Human PRSS12 protein, partial

Gene Name

PRSS12

UniProt

P56730

Expression Region

631-874aa

Organism

Homo sapiens (Human)

Target Sequence

IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.

Molecular Weight

43.4 kDa

References & Citations

"Cloning and sequencing of the cDNA encoding human neurotrypsin."Proba K., Gschwend T.P., Sonderegger P.Biochim. Biophys. Acta 1396:143-147 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOST Biosimilar Antibody
orb2669922-01 50 µg

SOST Biosimilar Antibody

Sign In for Pricing
View Details
SOST Biosimilar Antibody
orb2669922-02 100 µg

SOST Biosimilar Antibody

Sign In for Pricing
View Details
F18991-0000 Petri dish rack
1214109 1 Unit

F18991-0000 Petri dish rack

Sign In for Pricing
View Details
Calcium-binding mitochondrial carrier protein Aralar2 (SLC25A13) Human ELISA Kit
C0516 96 Tests

Calcium-binding mitochondrial carrier protein Aralar2 (SLC25A13) Human ELISA Kit

Sign In for Pricing
View Details
1,1,3-Trioxo-2- (prop-2-yn-1-yl) -2,3-dihydro-1,2-benzothiazole-6-carboxylic acid
GWB75055-01 50 mg

1,1,3-Trioxo-2- (prop-2-yn-1-yl) -2,3-dihydro-1,2-benzothiazole-6-carboxylic acid

Sign In for Pricing
View Details
1,1,3-Trioxo-2- (prop-2-yn-1-yl) -2,3-dihydro-1,2-benzothiazole-6-carboxylic acid
GWB75055-02 0.5 g

1,1,3-Trioxo-2- (prop-2-yn-1-yl) -2,3-dihydro-1,2-benzothiazole-6-carboxylic acid

Sign In for Pricing
View Details