Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vacuolar protein sorting-associated protein 13A (VPS13A), partial

Product Specifications

Product Name Alternative

Chorea-acanthocytosis protein Chorein

Abbreviation

Recombinant Human VPS13A protein, partial

Gene Name

VPS13A

UniProt

Q96RL7

Expression Region

3037-3140aa

Organism

Homo sapiens (Human)

Target Sequence

RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.

Molecular Weight

28.5 kDa

References & Citations

"Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 6:63-70 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcam1 Mouse Gene Knockout Kit (CRISPR)
KN517300 1 Kit

Tcam1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
o-Toluidine Chloride
TRC-T536215-50MG 50 mg

o-Toluidine Chloride

Sign In for Pricing
View Details
Vimentin (VM1170), 0.2mg/mL
BNUB1170-100 1x 100 µL

Vimentin (VM1170), 0.2mg/mL

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F10]
TA500498BM 100 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F10]

Sign In for Pricing
View Details
LAS1L Antibody
KC-20412-01 50 μL

LAS1L Antibody

Sign In for Pricing
View Details
LAS1L Antibody
KC-20412-02 100 µL

LAS1L Antibody

Sign In for Pricing
View Details