Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130), partial

Product Specifications

Product Name Alternative

130KDA Sin3-associated polypeptide Sin3-associated polypeptide p130

Abbreviation

Recombinant Mouse Sap130 protein, partial

Gene Name

Sap130

UniProt

Q8BIH0

Expression Region

845-1057aa

Organism

Mus musculus (Mouse)

Target Sequence

PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes (By similarity) .

Molecular Weight

28.8 kDa

References & Citations

"The transcriptional landscape of the mammalian genome."Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse IL-17A Antibody
RD30499F-01 25 µg

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IL-17A Antibody
RD30499F-02 100 µg

FITC Anti-Mouse IL-17A Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111R-01 20 Tests

Elab Fluor® Violet 500 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111R-02 100 Tests

Elab Fluor® Violet 500 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111R-03 2x 100 Tests

Elab Fluor® Violet 500 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
Acetylcholinesterase (AChE) Fluorescent Activity Kit
K015-F1 2 Plates

Acetylcholinesterase (AChE) Fluorescent Activity Kit

Sign In for Pricing
View Details