Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A.V (H2AFV)

Product Specifications

Product Name Alternative

H2A.F/Z

Abbreviation

Recombinant Human H2AFV protein

Gene Name

H2AFV

UniProt

Q71UI9

Expression Region

1-128aa

Organism

Homo sapiens (Human)

Target Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division (By similarity) .

Molecular Weight

29.5 kDa

References & Citations

"Precise characterization of human histones in the H2A gene family by top down mass spectrometry."Boyne M.T. II, Pesavento J.J., Mizzen C.A., Kelleher N.L.J. Proteome Res. 5:248-253 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

F(ab')2 Goat anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 650 Conjugated
MBS3900462-01 0.5 mg

F(ab')2 Goat anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 650 Conjugated

Ask
View Details
F(ab')2 Goat anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 650 Conjugated
MBS3900462-02 5x 0.5 mg

F(ab')2 Goat anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 650 Conjugated

Ask
View Details
Histones, pan (PE)
MBS6244365-01 0.1 mL

Histones, pan (PE)

Ask
View Details
Histones, pan (PE)
MBS6244365-02 5x 0.1 mL

Histones, pan (PE)

Ask
View Details
Recombinant Human EIF2AK2 Protein, His-SUMO, E.coli-200ug
QP5969-ec-200ug 200ug

Recombinant Human EIF2AK2 Protein, His-SUMO, E.coli-200ug

Ask
View Details
ADAMTS19, ID (A Disintegrin And Metalloproteinase With Thrombospondin Motifs 19, ADAMTS-19, ADAM-TS 19, ADAM-TS19) (MaxLight 750)
MBS6461541-01 0.1 mL

ADAMTS19, ID (A Disintegrin And Metalloproteinase With Thrombospondin Motifs 19, ADAMTS-19, ADAM-TS 19, ADAM-TS19) (MaxLight 750)

Ask
View Details