Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proepiregulin (EREG), partial

Product Specifications

Product Name Alternative

Epiregulin Short name: EPR

Abbreviation

Recombinant Human EREG protein, partial

Gene Name

EREG

UniProt

O14944

Expression Region

60-119aa

Organism

Homo sapiens (Human)

Target Sequence

VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYV

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation

Molecular Weight

22.9 kDa

References & Citations

"Distribution of mRNA for human epiregulin, a differentially expressed member of the epidermal growth factor family."Toyoda H., Komurasaki T., Uchida D., Morimoto S.Biochem. J. 326:69-75 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VTI1B Rabbit Polyclonal Antibody (AP)
orb963615 100 µL

VTI1B Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Geminin (F-7) AC
sc-74456 AC 500 µg/mL - 25% ag

Geminin (F-7) AC

Sign In for Pricing
View Details
Tris Buffer USP, 99-101% (Non Injectable Use)
16622-01 1 Kg

Tris Buffer USP, 99-101% (Non Injectable Use)

Sign In for Pricing
View Details
Tris Buffer USP, 99-101% (Non Injectable Use)
16622-02 5 Kg

Tris Buffer USP, 99-101% (Non Injectable Use)

Sign In for Pricing
View Details
At1g11620 Antibody
orb789100 2 mg

At1g11620 Antibody

Sign In for Pricing
View Details
C5orf34 Human shRNA Lentiviral Particle (Locus ID 375444)
TL307895V 500 µL Each

C5orf34 Human shRNA Lentiviral Particle (Locus ID 375444)

Sign In for Pricing
View Details