What is the catalog number for Recombinant Human Proepiregulin (EREG), partial?

The catalog number for Recombinant Human Proepiregulin (EREG), partial is CSB-EP007779HU.

What sizes are available for Recombinant Human Proepiregulin (EREG), partial?

Recombinant Human Proepiregulin (EREG), partial is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Proepiregulin (EREG), partial come in?

Recombinant Human Proepiregulin (EREG), partial is available in 3 different pack sizes.

Is Recombinant Human Proepiregulin (EREG), partial in stock?

Recombinant Human Proepiregulin (EREG), partial is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Proepiregulin (EREG), partial?

Recombinant Human Proepiregulin (EREG), partial is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Proepiregulin (EREG), partial?

Estimated delivery time for Recombinant Human Proepiregulin (EREG), partial is approximately 15 business day(s), depending on your location.

Recombinant Human Proepiregulin (EREG), partial

Product Specifications

Product Name Alternative

Epiregulin Short name: EPR

Abbreviation

Recombinant Human EREG protein, partial

Gene Name

EREG

UniProt

O14944

Expression Region

60-119aa

Organism

Homo sapiens (Human)

Target Sequence

VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYV

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation

Molecular Weight

22.9 kDa

References & Citations

"Distribution of mRNA for human epiregulin, a differentially expressed member of the epidermal growth factor family."Toyoda H., Komurasaki T., Uchida D., Morimoto S.Biochem. J. 326:69-75 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.