Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

Stable signal peptide Short name: SSP Glycoprotein G1 Short name: GP1 Glycoprotein G2 Short name: GP2

Abbreviation

Recombinant Lymphocytic choriomeningitis virus GPC protein, partial

Gene Name

GPC

UniProt

P09991

Expression Region

266-498aa

Organism

Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)

Target Sequence

GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Stable signal peptide is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.

Molecular Weight

42.4 kDa

References & Citations

"Molecular characterization of the genomic S RNA segment from lymphocytic choriomeningitis virus."Southern P.J., Singh M.K., Riviere Y., Jacoby D.R., Buchmeier M.J., Oldstone M.B.A.Virology 157:145-155 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB11 Polyclonal Antibody
MBS9128561-01 0.02 mL

ABCB11 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB11 Polyclonal Antibody
MBS9128561-02 0.1 mL

ABCB11 Polyclonal Antibody

Sign In for Pricing
View Details
ABCB11 Polyclonal Antibody
MBS9128561-03 5x 0.1 mL

ABCB11 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Pantothenate synthetase (panC)
MBS1001710-01 0.02 mg (E-Coli)

Recombinant Rhizobium sp. Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Pantothenate synthetase (panC)
MBS1001710-02 0.02 mg (Yeast)

Recombinant Rhizobium sp. Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Pantothenate synthetase (panC)
MBS1001710-03 0.1 mg (E-Coli)

Recombinant Rhizobium sp. Pantothenate synthetase (panC)

Sign In for Pricing
View Details