Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharum officinarum Sucrose synthase (SUS1), partial

Product Specifications

Product Name Alternative

Sucrose-UDP glucosyltransferase

Abbreviation

Recombinant Saccharum officinarum SUS1 protein, partial

Gene Name

SUS1

UniProt

P31925

Expression Region

1-218aa

Organism

Saccharum officinarum (Sugarcane)

Target Sequence

ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.

Molecular Weight

41.3 kDa

References & Citations

"Amplification and cloning of sugarcane sucrose synthase cDNA by anchored PCR."Kumar A.S., Moore P.H., Maretzki A.PCR Methods Appl. 2:70-75 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag
055703-01 10 µg

Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag
055703-02 50 µg

Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag
055703-03 100 µg

Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag
055703-04 200 µg

Solute Carrier Family 16, Member 1 (SLC16A1), Recombinant, Human, His-Tag, SUMO-Tag

Sign In for Pricing
View Details
TTLL11 Protein Vector (Human) (pPB-C-His)
PV141042 500 ng

TTLL11 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae rpsN Protein (aa 1-101) (strain ATCC 39315 / El Tor Inaba N16961)
VAng-Cr3022-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae rpsN Protein (aa 1-101) (strain ATCC 39315 / El Tor Inaba N16961)

Sign In for Pricing
View Details