Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36)

Product Specifications

Product Name Alternative

Myeloid antibacterial peptide 36

Abbreviation

Recombinant Pig PMAP36 protein

Gene Name

PMAP36

UniProt

P49931

Expression Region

130-166aa

Organism

Sus scrofa (Pig)

Target Sequence

VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Molecular Weight

20.3 kDa

References & Citations

"Chemical synthesis and biological activity of a novel antibacterial peptide deduced from a pig myeloid cDNA."Storici P., Scocchi M., Tossi A., Gennaro R., Zanetti M.FEBS Lett. 337:303-307 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD2 Protein Vector (Human) (pPB-C-His)
PV088642 500 ng

KCTD2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Methyl 4-hydroxy-3-iodobenzoate
FM41915-01 100 g

Methyl 4-hydroxy-3-iodobenzoate

Sign In for Pricing
View Details
Methyl 4-hydroxy-3-iodobenzoate
FM41915-02 250 g

Methyl 4-hydroxy-3-iodobenzoate

Sign In for Pricing
View Details
Methyl 4-hydroxy-3-iodobenzoate
FM41915-03 500 g

Methyl 4-hydroxy-3-iodobenzoate

Sign In for Pricing
View Details
Methyl 4-hydroxy-3-iodobenzoate
FM41915-04 1000 g

Methyl 4-hydroxy-3-iodobenzoate

Sign In for Pricing
View Details
Methyl 4-hydroxy-3-iodobenzoate
FM41915-05 2000 g

Methyl 4-hydroxy-3-iodobenzoate

Sign In for Pricing
View Details