Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial (Active)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human TMPRSS2 protein, partial (Active)

Gene Name

TMPRSS2

UniProt

O15393

Expression Region

106-492aa

Organism

Homo sapiens (Human)

Target Sequence

WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Tag

N-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein & Coronavirus Protein

Source

Yeast

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Recombinant Human TMPRSS2 His tag protein (CSB-YP023924HU) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM. ②Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-YP023924HU), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) . The Camostat Mesylate inhibit EC50 is 0.03347-0.07945μM.

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 450 Anti-human/ non-human primates CD83 Antibody *HB15e*
108300Z0-AAT 100 Tests

MFluor™ Violet 450 Anti-human/ non-human primates CD83 Antibody *HB15e*

Sign In for Pricing
View Details
GABARAP, NT (GABARAP, FLC3B, Gamma-aminobutyric acid receptor-associated protein, GABA (A) receptor-associated protein, MM46)
035839 200 µL

GABARAP, NT (GABARAP, FLC3B, Gamma-aminobutyric acid receptor-associated protein, GABA (A) receptor-associated protein, MM46)

Sign In for Pricing
View Details
Rat Nandrolone Phenylpropionate ELISA Kit
MBS045307-01 48 Well

Rat Nandrolone Phenylpropionate ELISA Kit

Sign In for Pricing
View Details
Rat Nandrolone Phenylpropionate ELISA Kit
MBS045307-02 96 Well

Rat Nandrolone Phenylpropionate ELISA Kit

Sign In for Pricing
View Details
Rat Nandrolone Phenylpropionate ELISA Kit
MBS045307-03 5x 96 Well

Rat Nandrolone Phenylpropionate ELISA Kit

Sign In for Pricing
View Details
Rat Nandrolone Phenylpropionate ELISA Kit
MBS045307-04 10x 96 Well

Rat Nandrolone Phenylpropionate ELISA Kit

Sign In for Pricing
View Details