Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S-arrestin (SAG)

Product Specifications

Product Name Alternative

48KDA protein Retinal S-antigen Short name: S-AG Rod photoreceptor arrestin

Abbreviation

Recombinant Human SAG protein

Gene Name

SAG

UniProt

P10523

Expression Region

1-405aa

Organism

Homo sapiens (Human)

Target Sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Arrestin is one of the major proteins of the ros (retinal rod outer segments) ; it binds to photoactivated-phosphorylated rhodopsin, thereby apparently preventing the transducin-mediated activation of phosphodiesterase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO (By similarity) . May play a role in preventing light-dependent degeneration of retinal photoreceptor cells

Molecular Weight

47.1 kDa

References & Citations

"The sequence of human retinal S-antigen reveals similarities with alpha-transducin."Yamaki K., Tsuda M., Shinohara T.FEBS Lett. 234:39-43 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIBAN2 (NM_022833) Human Recombinant Protein
TP320901L 1 mg

NIBAN2 (NM_022833) Human Recombinant Protein

Sign In for Pricing
View Details
Diphenyl Ditelluride
TRC-D491480-500MG 500 mg

Diphenyl Ditelluride

Sign In for Pricing
View Details
Erianin
TRC-E600075-50MG 50 mg

Erianin

Sign In for Pricing
View Details
Mouse Cep43 activation kit by CRISPRa
GA210161 1 Kit

Mouse Cep43 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details