Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5 (DRB5)

Product Specifications

Product Name Alternative

DsRNA-binding protein 5 Short name: AtDRB5

Abbreviation

Recombinant Mouse-ear cress DRB5 protein

Gene Name

DRB5

UniProt

Q8GY79

Expression Region

1-393aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Binds double-stranded RNA. May be involved in RNA-mediated silencing.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds double-stranded RNA. May be involved in RNA-mediated silencing.

Molecular Weight

45.6 kDa

References & Citations

"Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones."Sato S., Kaneko T., Kotani H., Nakamura Y., Asamizu E., Miyajima N., Tabata S.DNA Res. 5:41-54 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Block, 96 x 0.2ml or one PCR plate
H5000-02 1 Each

Block, 96 x 0.2ml or one PCR plate

Sign In for Pricing
View Details
Slc25a10 Mouse Gene Knockout Kit (CRISPR)
KN515955 1 Kit

Slc25a10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FYB2 (NM_001004303) Human Over-expression Lysate
LC424080 20 µg

FYB2 (NM_001004303) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR (31G7), CF568 conjugate, 0.1mg/mL
BNC681194-500 1x 500 µL

EGFR (31G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS702716 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Acetoxy Cyclosporin A Acetate
TRC-A164740-5MG 5 mg

Acetoxy Cyclosporin A Acetate

Sign In for Pricing
View Details