Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit gamma (CHRNG), partial

Product Specifications

Product Name Alternative

Acetylcholine receptor muscle gamma subunit; Acetylcholine receptor protein gamma chain precursor; Acetylcholine receptor subunit gamma; ACHG; ACHG_HUMAN; Achr 3; AChR; Achr3; ACHRG; ACRG; Cholinergic receptor nicotinic gamma; Cholinergic receptor nicotinic gamma polypeptide; CHRNG; MGC133376

Abbreviation

Recombinant Human CHRNG protein, partial

Gene Name

CHRNG

UniProt

P07510

Expression Region

23-240aa

Organism

Homo sapiens (Human)

Target Sequence

RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Molecular Weight

27.5 kDa

References & Citations

"Cloning and sequence analysis of human genomic DNA encoding gamma subunit precursor of muscle acetylcholine receptor."Shibahara S., Kubo T., Perski H.J., Takahashi H., Noda M., Numa S.Eur. J. Biochem. 146:15-22 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholipase A2 IIE/PLA2G2E Protein, Mouse, Recombinant (His Tag)
MBS8122912-01 0.1 mg

Phospholipase A2 IIE/PLA2G2E Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
Phospholipase A2 IIE/PLA2G2E Protein, Mouse, Recombinant (His Tag)
MBS8122912-02 5x 0.1 mg

Phospholipase A2 IIE/PLA2G2E Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
UGT1A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2583305 3x 1.0 µg

UGT1A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Canine Anti-Mullerian hormone (AMH) ELISA Kit
MBS2604842-01 48 Well

Canine Anti-Mullerian hormone (AMH) ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Mullerian hormone (AMH) ELISA Kit
MBS2604842-02 96 Well

Canine Anti-Mullerian hormone (AMH) ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Mullerian hormone (AMH) ELISA Kit
MBS2604842-03 5x 96 Well

Canine Anti-Mullerian hormone (AMH) ELISA Kit

Sign In for Pricing
View Details