Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)

Product Specifications

Product Name Alternative

MT2731; Antitoxin MT2731

Abbreviation

Recombinant Mycobacterium tuberculosis MT2731 protein

Gene Name

MT2731

UniProt

P9WJ10

Expression Region

1-81aa

Organism

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Target Sequence

MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Antitoxin component of a toxin-antitoxin (TA) module. Neutralizes the effect of cognate toxin MT2730

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MT2730 (By similarity) .

Molecular Weight

9.7 kDa

References & Citations

"Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnase-Free DNase I Kit-200p
25720 200 Reactions

Rnase-Free DNase I Kit-200p

Sign In for Pricing
View Details
Rab11b Mouse Gene Knockout Kit (CRISPR)
KN514325 1 Kit

Rab11b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF647 conjugate, 0.1mg/mL
BNC472592-100 1x 100 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Olig3 Antibody
RC-16467-01 50 μL

Recombinant Olig3 Antibody

Sign In for Pricing
View Details
Recombinant Olig3 Antibody
RC-16467-02 100 µL

Recombinant Olig3 Antibody

Sign In for Pricing
View Details
Recombinant Olig3 Antibody
RC-16467-03 1 mL

Recombinant Olig3 Antibody

Sign In for Pricing
View Details