Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ophiostoma ulmi CeRato-ulmin (CU)

Product Specifications

Product Name Alternative

Dutch elm disease toxin

Abbreviation

Recombinant Ophiostoma ulmi CeRato-ulmin protein

Gene Name

CU

UniProt

Q06153

Expression Region

26-100aa

Organism

Ophiostoma ulmi (Dutch elm disease fungus)

Target Sequence

SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

Molecular Weight

9.6 kDa

References & Citations

"Isolation and characterization of the cerato-ulmin toxin gene of the Dutch elm disease pathogen, Ophiostoma ulmi."Bowden C.G., Hintz W.E., Jeng R., Hubbes M., Horgen P.A.Curr. Genet. 25:323-329 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF594 conjugate, 0.1mg/mL
BNC941784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), CF740 conjugate, 0.1mg/mL
BNC741370-100 1x 100 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (B22.1 + B23.1), CF594 conjugate, 0.1mg/mL
BNC941221-100 1x 100 µL

Cytokeratin 8/18 (B22.1 + B23.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF640R conjugate, 0.1mg/mL
BNC400201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF594 conjugate, 0.1mg/mL
BNC940414-100 1x 100 µL

Chromogranin A (CGA/414), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details