Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial

Product Specifications

Product Name Alternative

LptD; imp; ostA; STY0108; t0096LPS-assembly protein LptD

Abbreviation

Recombinant Salmonella typhi lptD protein, partial

Gene Name

LptD

UniProt

Q8Z9J6

Expression Region

73-169aa

Organism

Salmonella typhi

Target Sequence

VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.

Molecular Weight

12.9 kDa

References & Citations

"Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18."Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. Barrell B.G.Nature 413:848-852 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein (High Purity)
#80013 1x 100 mg

Calcein (High Purity)

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF488A conjugate, 0.1mg/mL
BNC882685-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), Biotin conjugate, 0.1mg/mL
BNCB1010-500 1x 500 µL

Cytochrome C (CYCS/1010), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF647 conjugate, 0.1mg/mL
BNC471959-500 1x 500 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XFD700 acid
1799-AAT 10 mg

XFD700 acid

Sign In for Pricing
View Details
rac 2-Palmitoyl-3-chloropropanediol
TRC-P156510-5MG 5 mg

rac 2-Palmitoyl-3-chloropropanediol

Sign In for Pricing
View Details