Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial

Product Specifications

Product Name Alternative

LptD; imp; ostA; STY0108; t0096LPS-assembly protein LptD

Abbreviation

Recombinant Salmonella typhi lptD protein, partial

Gene Name

LptD

UniProt

Q8Z9J6

Expression Region

73-169aa

Organism

Salmonella typhi

Target Sequence

VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.

Molecular Weight

12.9 kDa

References & Citations

"Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18."Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. Barrell B.G.Nature 413:848-852 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAX Antibody
KC-6156-01 50 μL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-6156-02 100 µL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-6156-03 1 mL

BAX Antibody

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF405S conjugate, 0.1mg/mL
BNC041791-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1791), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), Biotin conjugate, 0.1mg/mL
BNCB0779-100 1x 100 µL

CD30 (Ki-1/779), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB500531 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details