What sizes are available for Recombinant Gloydius blomhoffii Disintegrin halysin?

Recombinant Gloydius blomhoffii Disintegrin halysin is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Gloydius blomhoffii Disintegrin halysin come in?

Recombinant Gloydius blomhoffii Disintegrin halysin is available in 3 different pack sizes.

Who manufactures Recombinant Gloydius blomhoffii Disintegrin halysin?

Recombinant Gloydius blomhoffii Disintegrin halysin is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Gloydius blomhoffii Disintegrin halysin?

Estimated delivery time for Recombinant Gloydius blomhoffii Disintegrin halysin is approximately 15 business day(s), depending on your location.

Recombinant Gloydius blomhoffii Disintegrin halysin

Q: What is the catalog number for Recombinant Gloydius blomhoffii Disintegrin halysin?

The catalog number for Recombinant Gloydius blomhoffii Disintegrin halysin is CSB-YP322037GGN.

Q: Is Recombinant Gloydius blomhoffii Disintegrin halysin in stock?

Recombinant Gloydius blomhoffii Disintegrin halysin is currently made to order / not held in immediate stock. Contact us for lead time.

Product Specifications

Product Name Alternative

Platelet aggregation activation inhibitor

Abbreviation

Recombinant Gloydius blomhoffii Disintegrin halysin protein

UniProt

P21858

Expression Region

1-71aa

Organism

Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)

Target Sequence

EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Molecular Weight

9.5 kDa

References & Citations

"Halysin, an antiplatelet Arg-Gly-Asp-containing snake venom peptide, as fibrinogen receptor antagonist."Huang T.-F., Liu C.-S., Ouyang C.H., Teng C.-M.Biochem. Pharmacol. 42:1209-1219 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.