Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transforming growth factor beta-1 (tgfb1)

Product Specifications

Product Name Alternative

Short name: TGF-beta-1 Alternative name (s) : TGF-beta-5

Abbreviation

Recombinant Xenopus laevis tgfb1 protein

Gene Name

Tgfb1

UniProt

P16176

Expression Region

271-382aa

Organism

Xenopus laevis (African clawed frog)

Target Sequence

GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Important role in certain aspects of differentiation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Important role in certain aspects of differentiation.

Molecular Weight

28.6 kDa

References & Citations

"Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPAM Polyclonal Antibody
E-AB-11282-01 20 µL

GPAM Polyclonal Antibody

Sign In for Pricing
View Details
GPAM Polyclonal Antibody
E-AB-11282-02 60 µL

GPAM Polyclonal Antibody

Sign In for Pricing
View Details
GPAM Polyclonal Antibody
E-AB-11282-03 120 µL

GPAM Polyclonal Antibody

Sign In for Pricing
View Details
GPAM Polyclonal Antibody
E-AB-11282-04 200 µL

GPAM Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS801781 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
MCL1 Mouse Monoclonal Antibody [Clone ID: 8C6 (8C6D4B1)]
AM06096PU-N 100 µL

MCL1 Mouse Monoclonal Antibody [Clone ID: 8C6 (8C6D4B1)]

Sign In for Pricing
View Details