Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 96 (Ly96)

Product Specifications

Product Name Alternative

Short name: Ly-96 Alternative name (s) : ESOP-1 Protein MD-2

Abbreviation

Recombinant Mouse Ly96 protein

Gene Name

Ly96

UniProt

Q9JHF9

Expression Region

19-160aa

Organism

Mus musculus (Mouse)

Target Sequence

EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both MD2 and TLR4, but not TLR4 alone, respond to LPS

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds bacterial lipopolysaccharide (LPS)

Molecular Weight

32.4 kDa

References & Citations

"ESOP-1, a secreted protein expressed in the hematopoietic, nervous, and reproductive systems of embryonic and adult mice."Kato K., Morrison A.M., Nakano T., Tashiro K., Honjo T.Blood 96:362-364 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Recombinant Monoclonal Mouse Antibody (2304.63) – Biotium Choice
P013-1MG 1x 200 µL

CD63 Recombinant Monoclonal Mouse Antibody (2304.63) – Biotium Choice

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF488A conjugate, 0.1mg/mL
BNC881457-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Texas Red® goat anti-rabbit IgG (H+L)
16869-AAT 1 mg

Texas Red® goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
DIDO1 Antibody
8C13042-AAT 50 µg

DIDO1 Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD Protein (C-hFc Tag) (Omicron)
PKSV030476 100 µg

Recombinant SARS-CoV-2 Spike RBD Protein (C-hFc Tag) (Omicron)

Sign In for Pricing
View Details
Acetyl-1,2-13C2 Coenzyme A Sodium Salt (~2% Unlabelled)
TRC-A172214-5MG 5 mg

Acetyl-1,2-13C2 Coenzyme A Sodium Salt (~2% Unlabelled)

Sign In for Pricing
View Details