Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 96 (Ly96)

Product Specifications

Product Name Alternative

Short name: Ly-96 Alternative name (s) : ESOP-1 Protein MD-2

Abbreviation

Recombinant Mouse Ly96 protein

Gene Name

Ly96

UniProt

Q9JHF9

Expression Region

19-160aa

Organism

Mus musculus (Mouse)

Target Sequence

EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both MD2 and TLR4, but not TLR4 alone, respond to LPS

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds bacterial lipopolysaccharide (LPS)

Molecular Weight

32.4 kDa

References & Citations

"ESOP-1, a secreted protein expressed in the hematopoietic, nervous, and reproductive systems of embryonic and adult mice."Kato K., Morrison A.M., Nakano T., Tashiro K., Honjo T.Blood 96:362-364 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DKK1 Antibody Pair Set
E-KAB-0522 50 µL & 100 µg

Human DKK1 Antibody Pair Set

Sign In for Pricing
View Details
96 deep square well 2.0mL polyethylene toughened genomics plate
IPD1196-MP 1 Each

96 deep square well 2.0mL polyethylene toughened genomics plate

Sign In for Pricing
View Details
Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein
TP308964 20 µg

Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein

Sign In for Pricing
View Details
KRAS Rabbit Polyclonal Antibody
TA372918 100 µL

KRAS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC682562-500 1x 500 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LAD1 (N-term) Rabbit Polyclonal Antibody
AP52438PU-N 400 µL

LAD1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details