Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Osteocalcin (Bglap)

Product Specifications

Product Name Alternative

Bone Gla protein Short name: BGP Gamma-carboxyglutamic acid-containing protein

Abbreviation

Recombinant Mouse Bglap protein

Gene Name

Bglap

UniProt

P86546

Expression Region

50-95aa

Organism

Mus musculus (Mouse)

Target Sequence

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Molecular Weight

21.1 kDa

References & Citations

"The mouse osteocalcin gene cluster contains three genes with two separate spatial and temporal patterns of expression."Desbois C., Hogue D.A., Karsenty G.J. Biol. Chem. 269:1183-1190 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXNC1 Protein Vector (Mouse) (pPB-C-His)
PV217386 500 ng

PLXNC1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GDF6 Rabbit pAb
E47R11843 100 µL

GDF6 Rabbit pAb

Sign In for Pricing
View Details
NRIP1 Adenovirus (Human)
32169051 1.0 mL

NRIP1 Adenovirus (Human)

Sign In for Pricing
View Details
Human alpha-fetoprotein Lens culinaris agglutiin 1,AFP-L1 ELISA KIT
JOT-EK1823Hu 96 wells

Human alpha-fetoprotein Lens culinaris agglutiin 1,AFP-L1 ELISA KIT

Sign In for Pricing
View Details
BATF3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0171202 1.0 µg DNA

BATF3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Canine Ataxin 2 ELISA kit
GTR10424521 96 Well

Canine Ataxin 2 ELISA kit

Sign In for Pricing
View Details