Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Major allergen Equ c 1

Product Specifications

Product Name Alternative

Allergen: Equ c 1

Abbreviation

Recombinant Horse Major allergen Equ c 1 protein

UniProt

Q95182

Expression Region

16-187aa

Organism

Equus caballus (Horse)

Target Sequence

QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.1 kDa

References & Citations

"cDNA cloning and sequencing reveal the major horse allergen Equ c1 to be a glycoprotein member of the lipocalin superfamily."Gregoire C., Rosinski-Chupin I., Rabillon J., Alzari P.M., David B., Dandeu J.-P.J. Biol. Chem. 271:32951-32959 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEN2 Rabbit Monoclonal Antibody
AMRe03142-01 1 Each

PEN2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PEN2 Rabbit Monoclonal Antibody
AMRe03142-02 50 µL

PEN2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PEN2 Rabbit Monoclonal Antibody
AMRe03142-03 100 µL

PEN2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
15-Deoxyoxalicine B
MF-0020469-01 1 mg

15-Deoxyoxalicine B

Sign In for Pricing
View Details
15-Deoxyoxalicine B
MF-0020469-02 5 mg

15-Deoxyoxalicine B

Sign In for Pricing
View Details
ANKRD36C Human qPCR Primer Pair (NM_001010914)
HP202091 200 Reactions

ANKRD36C Human qPCR Primer Pair (NM_001010914)

Sign In for Pricing
View Details