Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial

Product Specifications

Product Name Alternative

CD_antigen: CD242

Abbreviation

Recombinant Mouse Icam4 protein, partial

Gene Name

Icam4

UniProt

Q9ERM2

Expression Region

23-231aa

Organism

Mus musculus (Mouse)

Target Sequence

QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity) . Isoform 2 may modulate binding of membrane-associated ICAM4.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity) . Isoform 2 may modulate binding of membrane-associated ICAM4.

Molecular Weight

39.1 kDa

References & Citations

"Novel secreted isoform of adhesion molecule ICAM-4: potential regulator of membrane-associated ICAM-4 interactions."Lee G., Spring F.A., Parsons S.F., Mankelow T.J., Peters L.L., Koury M.J., Mohandas N., Anstee D.J., Chasis J.A.Blood 101:1790-1797 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microscope Slides- Cerebral Cortex of rat QQ47
4042957 1 Each

Microscope Slides- Cerebral Cortex of rat QQ47

Sign In for Pricing
View Details
PAK1 (p21 GTPase activated protein kinase 1) (Biotin)
MBS6491803-01 0.1 mL

PAK1 (p21 GTPase activated protein kinase 1) (Biotin)

Sign In for Pricing
View Details
PAK1 (p21 GTPase activated protein kinase 1) (Biotin)
MBS6491803-02 5x 0.1 mL

PAK1 (p21 GTPase activated protein kinase 1) (Biotin)

Sign In for Pricing
View Details
HUNK (hormonally up-Regulated Neu-Associated Kinase) (MaxLight 405) discontinued
247340-ML405 100 µL

HUNK (hormonally up-Regulated Neu-Associated Kinase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA), Recombinant, Rat, His-Tag
054028-01 10 µg

Carcinoembryonic Antigen (CEA), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA), Recombinant, Rat, His-Tag
054028-02 50 µg

Carcinoembryonic Antigen (CEA), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details