Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oxyopes takobius Oxyopinin-4a

Product Specifications

Product Name Alternative

Oxt-4a

Abbreviation

Recombinant Oxyopes takobius Oxyopinin-4a protein

UniProt

F8J4S0

Expression Region

48-77aa

Organism

Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)

Target Sequence

GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Disrupts cell membranes through the formation of pores (Probable) . Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 µM) and B.subtilis (MIC=0.5 µM) as well as Gram-negative bacteria P.fluorescens (MIC=1 µM) and E.coli (MIC=0.5 µM) . Has hemolytic activity against human erythrocytes (EC (50) =7 µM)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Disrupts cell membranes through the formation of pores (Probable) . Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 uM) and B.subtilis (MIC=0.5 uM) as well as Gram-negative bacteria P.fluorescens (MIC=1 uM) and E.coli (MIC=0.5 uM) . Has hemolytic activity against human erythrocytes (EC (50) =7 uM) .

Molecular Weight

19.6 kDa

References & Citations

"Novel lynx spider toxin shares common molecular architecture with defense peptides from frog skin."Dubovskii P.V., Vassilevski A.A., Samsonova O.V., Egorova N.S., Kozlov S.A., Feofanov A.V., Arseniev A.S., Grishin E.V.FEBS J. 278:4382-4393 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

InVivoMAb Anti-Human IGF2 (Iv0064)
VHB94101 100 μg

InVivoMAb Anti-Human IGF2 (Iv0064)

Sign In for Pricing
View Details
ACSM3 Polyclonal Antibody, HRP Conjugated
bs-7641R-HRP 100 µL

ACSM3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Hsa-miR-10393-5p agomir
HY-R00023A-01 5 nmol

Hsa-miR-10393-5p agomir

Sign In for Pricing
View Details
Hsa-miR-10393-5p agomir
HY-R00023A-02 20 nmol

Hsa-miR-10393-5p agomir

Sign In for Pricing
View Details
Purified anti-human CD14
GT07138 25 µg

Purified anti-human CD14

Sign In for Pricing
View Details
Recombinant Human R-spondin-2/RSPO2 Protein
RP03266-01 20 μg

Recombinant Human R-spondin-2/RSPO2 Protein

Sign In for Pricing
View Details