Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 11 (GDF11)

Product Specifications

Product Name Alternative

Bone morphogenetic protein 11 Short name: BMP-11

Abbreviation

Recombinant Human GDF11 protein

Gene Name

GDF11

UniProt

O95390

Expression Region

299-407aa

Organism

Homo sapiens (Human)

Target Sequence

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. May play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern (By similarity) . Signals through activin receptors type-2, ACVR2A and ACVR2B, and activin receptors type-1, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3

Molecular Weight

28.5 kDa

References & Citations

"A novel BMP expressed in developing mouse limb, spinal cord, and tail bud is a potent mesoderm inducer in Xenopus embryos."Gamer L.W., Wolfman N.M., Celeste A.J., Hattersley G., Hewick R., Rosen V.Dev. Biol. 208:222-232 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRA2A Antibody
orb652604 100 µL

ADRA2A Antibody

Sign In for Pricing
View Details
Anti-STING1/TMEM173 Polyclonal Antibody
PHJ16701 100 μg

Anti-STING1/TMEM173 Polyclonal Antibody

Sign In for Pricing
View Details
IL6 Antibody (Biotin)
orb1272695 0.05 mg

IL6 Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral human HSD3B7 shRNA (UAS) - Lentiviral human HSD3B7 shRNA (UAS) (100)
GTR15335697 1 Vial

Lentiviral human HSD3B7 shRNA (UAS) - Lentiviral human HSD3B7 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rat Complement Factor H Related Protein 3 (CFHR3) ELISA Kit
MBS163359-01 48 Well

Rat Complement Factor H Related Protein 3 (CFHR3) ELISA Kit

Sign In for Pricing
View Details
Rat Complement Factor H Related Protein 3 (CFHR3) ELISA Kit
MBS163359-02 96 Well

Rat Complement Factor H Related Protein 3 (CFHR3) ELISA Kit

Sign In for Pricing
View Details